Fibrinogen gamma Chain Antibody (Biotin)

Catalog number KB-1685-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1685-01

Size / count 50 μL

Specifications

Catalog number: KB-1685-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Fibrinogen gamma chain
Gene Name: FGG
Gene ID: 2266
UniProt: P02679
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FGG
Target: PP-5737
Partner Proteins: Fibrinogen gamma chain
Clone: K24024_2E1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 71%, Pig - 75%, Cynomolgus monkey - 90%
Purity: ≥85%
Cores: KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Fibrinogen gamma Chain
Host or Source: Mouse
Protein Name: Fibrinogen gamma chain
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Fibrinogen gamma Chain Antibody (Biotin)?

The catalog number for Fibrinogen gamma Chain Antibody (Biotin) is KB-1685.

What sizes are available for Fibrinogen gamma Chain Antibody (Biotin)?

Fibrinogen gamma Chain Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Fibrinogen gamma Chain Antibody (Biotin) come in?

Fibrinogen gamma Chain Antibody (Biotin) is available in 3 different pack sizes.

Is Fibrinogen gamma Chain Antibody (Biotin) in stock?

Fibrinogen gamma Chain Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.