Alpha A Crystallin Antibody (Biotin)

Catalog number KB-8221-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8221-01

Size / count 50 μL

Specifications

Catalog number: KB-8221-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Alpha-crystallin A chain, Heat shock protein beta-4, HspB4) [Cleaved into: Alpha-crystallin A (1-172, Alpha-crystallin A (1-168, Alpha-crystallin A (1-162]
Gene Name: CRYAA
Gene ID: 1409
UniProt: P02489
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CRYAA
Target: PP-10652
Partner Proteins: Alpha-crystallin A chain; Heat shock protein beta-4; HspB4) [Cleaved into: Alpha-crystallin A (1-172; Alpha-crystallin A (1-168; Alpha-crystallin A (1-162]
Clone: K8U013_11C4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CRYA1; HSPB4
Target Alternative Name: Alpha A Crystallin
Host or Source: Mouse
Protein Name: Crystallin alpha A
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Alpha A Crystallin Antibody (Biotin)?

The catalog number for Alpha A Crystallin Antibody (Biotin) is KB-8221.

What sizes are available for Alpha A Crystallin Antibody (Biotin)?

Alpha A Crystallin Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha A Crystallin Antibody (Biotin) come in?

Alpha A Crystallin Antibody (Biotin) is available in 3 different pack sizes.

Is Alpha A Crystallin Antibody (Biotin) in stock?

Alpha A Crystallin Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products