Alpha A Crystallin Antibody

Catalog number KC-17722-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-17722-01

Size / count 50 μL

Specifications

Catalog number: KC-17722-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Alpha-crystallin A chain, Heat shock protein beta-4, HspB4) [Cleaved into: Alpha-crystallin A (1-172, Alpha-crystallin A (1-168, Alpha-crystallin A (1-162]
Gene Name: CRYAA
Gene ID: 1409
UniProt: P02489
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CRYAA
Target: PP-10652
Partner Proteins: Alpha-crystallin A chain; Heat shock protein beta-4; HspB4) [Cleaved into: Alpha-crystallin A (1-172; Alpha-crystallin A (1-168; Alpha-crystallin A (1-162]
Clone: K8U013_12C3
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CRYA1; HSPB4
Target Alternative Name: Alpha A Crystallin
Host or Source: Mouse
Protein Name: Crystallin alpha A
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Alpha A Crystallin Antibody?

The catalog number for Alpha A Crystallin Antibody is KC-17722.

What sizes are available for Alpha A Crystallin Antibody?

Alpha A Crystallin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha A Crystallin Antibody come in?

Alpha A Crystallin Antibody is available in 3 different pack sizes.

Is Alpha A Crystallin Antibody in stock?

Alpha A Crystallin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.