IL-1 alpha Antibody

Catalog number KC-9711-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-9711-01

Size / count 50 μL

Specifications

Catalog number: KC-9711-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-1 alpha, IL-1 alpha, Hematopoietin-1
Gene Name: IL1A
Gene ID: 3552
UniProt: P01583
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL1A
Target: PP-064
Partner Proteins: Interleukin-1 alpha; IL-1 alpha; Hematopoietin-1
Clone: K24011_12H10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 59%, Pig - 67%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IL1F1
Target Alternative Name: IL-1 alpha
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Interleukin 1 alpha
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for IL-1 alpha Antibody?

The catalog number for IL-1 alpha Antibody is KC-9711.

What sizes are available for IL-1 alpha Antibody?

IL-1 alpha Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL-1 alpha Antibody come in?

IL-1 alpha Antibody is available in 3 different pack sizes.

Is IL-1 alpha Antibody in stock?

IL-1 alpha Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products