PPY Antibody (Biotin)

Catalog number KB-8371-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8371-01

Size / count 50 μL

Specifications

Catalog number: KB-8371-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Pancreatic polypeptide prohormone, PH, Pancreatic polypeptide Y, Obinepitide) [Cleaved into: Pancreatic polypeptide, HPP, PP, Pancreatic icosapeptide, PI]
Gene Name: PPY
Gene ID: 5539
UniProt: P01298
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PPY
Target: PP-3044
Partner Proteins: Pancreatic polypeptide prohormone; PH; Pancreatic polypeptide Y; Obinepitide) [Cleaved into: Pancreatic polypeptide; HPP; PP; Pancreatic icosapeptide; PI]
Clone: K52075_9G3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 80%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPREL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: PNP
Target Alternative Name: PPY
Host or Source: Mouse
Protein Name: Pancreatic polypeptide
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PPY Antibody (Biotin)?

The catalog number for PPY Antibody (Biotin) is KB-8371.

What sizes are available for PPY Antibody (Biotin)?

PPY Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PPY Antibody (Biotin) come in?

PPY Antibody (Biotin) is available in 3 different pack sizes.

Is PPY Antibody (Biotin) in stock?

PPY Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.