Adenosine Deaminase Antibody (Biotin)

Catalog number KB-3206-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3206-01

Size / count 50 μL

Specifications

Catalog number: KB-3206-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Adenosine deaminase, Adenosine aminohydrolase
Gene Name: ADA
Gene ID: 100
UniProt: P00813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADA
Target: PP-1636
Partner Proteins: Adenosine deaminase; Adenosine aminohydrolase
Clone: K40075_10G11
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ADA1
Target Alternative Name: Adenosine Deaminase
Host or Source: Mouse
Protein Name: Adenosine deaminase
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Adenosine Deaminase Antibody (Biotin)?

The catalog number for Adenosine Deaminase Antibody (Biotin) is KB-3206.

What sizes are available for Adenosine Deaminase Antibody (Biotin)?

Adenosine Deaminase Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Adenosine Deaminase Antibody (Biotin) come in?

Adenosine Deaminase Antibody (Biotin) is available in 3 different pack sizes.

Is Adenosine Deaminase Antibody (Biotin) in stock?

Adenosine Deaminase Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.