Recombinant ANGPTL1 Antibody

Catalog number RN-14707-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14707-01

Size / count 50 μL

Specifications

Catalog number: RN-14707-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Angiopoietin-related protein 1, Angiopoietin-3, ANG-3, Angiopoietin-like protein 1
Gene Name: ANGPTL1
Gene ID: 9068
UniProt: O95841
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANGPTL1
Target: PP-1548
Partner Proteins: Angiopoietin-related protein 1; Angiopoietin-3; ANG-3; Angiopoietin-like protein 1
Clone: K1H039_15D4
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: QDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
WB Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ANG3; ANGPT3; ARP1
Target Alternative Name: ANGPTL1
Host or Source: Mouse
Protein Name: Angiopoietin like 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ANGPTL1 Antibody?

The catalog number for Recombinant ANGPTL1 Antibody is RN-14707.

What sizes are available for Recombinant ANGPTL1 Antibody?

Recombinant ANGPTL1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ANGPTL1 Antibody come in?

Recombinant ANGPTL1 Antibody is available in 3 different pack sizes.

Is Recombinant ANGPTL1 Antibody in stock?

Recombinant ANGPTL1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.