STAMBP Antibody (Biotin)

Catalog number KB-3669-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-3669-01

Size / count 50 μL

Specifications

Catalog number: KB-3669-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: STAM-binding protein, Associated molecule with the SH3 domain of STAM, Endosome-associated ubiquitin isopeptidase
Gene Name: STAMBP
Gene ID: 10617
UniProt: O95630
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human STAMBP
Target: PP-714
Partner Proteins: STAM-binding protein; Associated molecule with the SH3 domain of STAM; Endosome-associated ubiquitin isopeptidase
Clone: K56003_13D7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 81%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: AMSH
Target Alternative Name: STAMBP
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: STAM binding protein
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for STAMBP Antibody (Biotin)?

The catalog number for STAMBP Antibody (Biotin) is KB-3669.

What sizes are available for STAMBP Antibody (Biotin)?

STAMBP Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does STAMBP Antibody (Biotin) come in?

STAMBP Antibody (Biotin) is available in 3 different pack sizes.

Is STAMBP Antibody (Biotin) in stock?

STAMBP Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products