Recombinant WDR47 Antibody

Catalog number RN-13787-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13787-01

Size / count 50 μL

Specifications

Catalog number: RN-13787-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: WD repeat-containing protein 47, Neuronal enriched MAP-interacting protein, Nemitin
Gene Name: WDR47
Gene ID: 22911
UniProt: O94967
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WDR47
Target: PP-7477
Partner Proteins: WD repeat-containing protein 47; Neuronal enriched MAP-interacting protein; Nemitin
Clone: K29089_1C7
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: DSTEQFQEYYRQRLRYQQHLEQKEQQRQIYQQMLLEGGVNQEDGPDQQQNLTEQFLNRSIQKLGELNIGMDGLGNEVSALNQQCNGSKGNGSNGSSVTSFTTPPQDSSQRLTHDASNIHTSTPRNPGSTNHIPFLEESPCGSQISSEHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0893
Target Alternative Name: WDR47
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: WD repeat domain 47
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant WDR47 Antibody?

The catalog number for Recombinant WDR47 Antibody is RN-13787.

What sizes are available for Recombinant WDR47 Antibody?

Recombinant WDR47 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant WDR47 Antibody come in?

Recombinant WDR47 Antibody is available in 3 different pack sizes.

Is Recombinant WDR47 Antibody in stock?

Recombinant WDR47 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.