Gamma Sarcoglycan Antibody

Catalog number KC-19389-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19389-01

Size / count 50 μL

Specifications

Catalog number: KC-19389-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Gamma-synuclein, Breast cancer-specific gene 1 protein, Persyn, Synoretin, SR
Gene Name: SNCG
Gene ID: 6623
UniProt: O76070
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SNCG
Target: PP-037
Partner Proteins: Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR
Clone: K40066_12E7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 89%, Pig - 90%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BCSG1; PERSYN; PRSN
Target Alternative Name: Gamma Synuclein/SNCG
Host or Source: Mouse
Protein Name: Synuclein gamma
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Gamma Sarcoglycan Antibody?

The catalog number for Gamma Sarcoglycan Antibody is KC-19389.

What sizes are available for Gamma Sarcoglycan Antibody?

Gamma Sarcoglycan Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Gamma Sarcoglycan Antibody come in?

Gamma Sarcoglycan Antibody is available in 3 different pack sizes.

Is Gamma Sarcoglycan Antibody in stock?

Gamma Sarcoglycan Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products