Gamma Sarcoglycan Antibody

Catalog number KC-18186-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-18186-01

Size / count 50 μL

Specifications

Catalog number: KC-18186-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Gamma-synuclein, Breast cancer-specific gene 1 protein, Persyn, Synoretin, SR
Gene Name: SNCG
Gene ID: 6623
UniProt: O76070
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SNCG
Target: PP-037
Partner Proteins: Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR
Clone: K40066_18D12
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 89%, Pig - 90%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: BCSG1; PERSYN; PRSN
Target Alternative Name: Gamma Synuclein/SNCG
Host or Source: Mouse
Protein Name: Synuclein gamma
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Gamma Sarcoglycan Antibody?

The catalog number for Gamma Sarcoglycan Antibody is KC-18186.

What sizes are available for Gamma Sarcoglycan Antibody?

Gamma Sarcoglycan Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Gamma Sarcoglycan Antibody come in?

Gamma Sarcoglycan Antibody is available in 3 different pack sizes.

Is Gamma Sarcoglycan Antibody in stock?

Gamma Sarcoglycan Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

All Products