RGS9 Antibody (Biotin)

Catalog number KB-28556-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-28556-01

Size / count 50 μL

Specifications

Catalog number: KB-28556-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Regulator of G-protein signaling 9, RGS9
Gene Name: RGS9
Gene ID: 8787
UniProt: O75916
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RGS9
Target: PP-6470
Partner Proteins: Regulator of G-protein signaling 9; RGS9
Clone: K24059_14C6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: RGS9
Host or Source: Mouse
Protein Name: Regulator of G protein signaling 9
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RGS9 Antibody (Biotin)?

The catalog number for RGS9 Antibody (Biotin) is KB-28556.

What sizes are available for RGS9 Antibody (Biotin)?

RGS9 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RGS9 Antibody (Biotin) come in?

RGS9 Antibody (Biotin) is available in 3 different pack sizes.

Is RGS9 Antibody (Biotin) in stock?

RGS9 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.