APRIL Antibody (Biotin)

Catalog number KB-22942-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-22942-01

Size / count 50 μL

Specifications

Catalog number: KB-22942-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor ligand superfamily member 13, A proliferation-inducing ligand, APRIL, TNF- and APOL-related leukocyte expressed ligand 2, TALL-2, TNF-related death ligand 1, TRDL-1, CD antigen CD256
Gene Name: TNFSF13
Gene ID: 8741
UniProt: O75888
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFSF13
Target Antigen: CD256
Target: P02055PAD
Partner Proteins: Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand; APRIL; TNF- and APOL-related leukocyte expressed ligand 2; TALL-2; TNF-related death ligand 1; TRDL-1; CD antigen CD256
Clone: K29071_20E7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Pig - 85%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: QKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: APRIL; TALL2; ZTNF2
Target Alternative Name: APRIL
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: TNF superfamily member 13
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for APRIL Antibody (Biotin)?

The catalog number for APRIL Antibody (Biotin) is KB-22942.

What sizes are available for APRIL Antibody (Biotin)?

APRIL Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does APRIL Antibody (Biotin) come in?

APRIL Antibody (Biotin) is available in 3 different pack sizes.

Is APRIL Antibody (Biotin) in stock?

APRIL Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.