TNFRSF21 Antibody (Biotin)

Catalog number KB-23333-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-23333-01

Size / count 50 μL

Specifications

Catalog number: KB-23333-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor receptor superfamily member 21, Death receptor 6, CD antigen CD358
Gene Name: TNFRSF21
Gene ID: 27242
UniProt: O75509
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFRSF21
Target Antigen: CD358
Target: PP-704
Partner Proteins: Tumor necrosis factor receptor superfamily member 21; Death receptor 6; CD antigen CD358
Clone: K40080_4B8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Rat - 77%, Pig - 89%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DR6
Target Alternative Name: TNFRSF21
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: TNF receptor superfamily member 21
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TNFRSF21 Antibody (Biotin)?

The catalog number for TNFRSF21 Antibody (Biotin) is KB-23333.

What sizes are available for TNFRSF21 Antibody (Biotin)?

TNFRSF21 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFRSF21 Antibody (Biotin) come in?

TNFRSF21 Antibody (Biotin) is available in 3 different pack sizes.

Is TNFRSF21 Antibody (Biotin) in stock?

TNFRSF21 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.