TNFRSF21 Antibody (Biotin)

Catalog number KB-23324-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-23324-01

Size / count 50 μL

Specifications

Catalog number: KB-23324-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor receptor superfamily member 21, Death receptor 6, CD antigen CD358
Gene Name: TNFRSF21
Gene ID: 27242
UniProt: O75509
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFRSF21
Target Antigen: CD358
Target: PP-704
Partner Proteins: Tumor necrosis factor receptor superfamily member 21; Death receptor 6; CD antigen CD358
Clone: K40080_10E5
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Rat - 77%, Pig - 89%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: DR6
Target Alternative Name: TNFRSF21
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: TNF receptor superfamily member 21
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for TNFRSF21 Antibody (Biotin)?

The catalog number for TNFRSF21 Antibody (Biotin) is KB-23324.

What sizes are available for TNFRSF21 Antibody (Biotin)?

TNFRSF21 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFRSF21 Antibody (Biotin) come in?

TNFRSF21 Antibody (Biotin) is available in 3 different pack sizes.

Is TNFRSF21 Antibody (Biotin) in stock?

TNFRSF21 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products