ADAMTS4 Antibody (Biotin)

Catalog number KB-27321-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-27321-01

Size / count 50 μL

Specifications

Catalog number: KB-27321-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: A disintegrin and metalloproteinase with thrombospondin motifs 4, ADAM-TS 4, ADAM-TS4, ADAMTS-4, ADMP-1, Aggrecanase-1
Gene Name: ADAMTS4
Gene ID: 9507
UniProt: O75173
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADAMTS4
Target: PP-11412
Partner Proteins: A disintegrin and metalloproteinase with thrombospondin motifs 4; ADAM-TS 4; ADAM-TS4; ADAMTS-4; ADMP-1; Aggrecanase-1
Clone: K1E072_14B8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRSCN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0688
Target Alternative Name: ADAMTS4
Host or Source: Mouse
Protein Name: ADAM metallopeptidase with thrombospondin type 1 motif 4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for ADAMTS4 Antibody (Biotin)?

The catalog number for ADAMTS4 Antibody (Biotin) is KB-27321.

What sizes are available for ADAMTS4 Antibody (Biotin)?

ADAMTS4 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does ADAMTS4 Antibody (Biotin) come in?

ADAMTS4 Antibody (Biotin) is available in 3 different pack sizes.

Is ADAMTS4 Antibody (Biotin) in stock?

ADAMTS4 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products