Recombinant LILRB5 Antibody

Catalog number RC-8551-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-8551-01

Size / count 50 μL

Specifications

Catalog number: RC-8551-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leukocyte immunoglobulin-like receptor subfamily B member 5, CD85 antigen-like family member C, Leukocyte immunoglobulin-like receptor 8, LIR-8, CD antigen CD85c
Gene Name: LILRB5
Gene ID: 10990
UniProt: O75023
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LILRB5
Target Antigen: CD85c
Target: PP-1184
Partner Proteins: Leukocyte immunoglobulin-like receptor subfamily B member 5; CD85 antigen-like family member C; Leukocyte immunoglobulin-like receptor 8; LIR-8; CD antigen CD85c
Clone: K70032_3B3
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 41%, Rat - 34%, Pig - 60%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: AHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDAPAAASEAPQDVTYAQLHSLTLRREATEPP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 41%
Recombinant Antibody: Yes
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: LIR8
Target Alternative Name: LILRB5
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Leukocyte immunoglobulin like receptor B5
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant LILRB5 Antibody?

The catalog number for Recombinant LILRB5 Antibody is RC-8551.

What sizes are available for Recombinant LILRB5 Antibody?

Recombinant LILRB5 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant LILRB5 Antibody come in?

Recombinant LILRB5 Antibody is available in 3 different pack sizes.

Is Recombinant LILRB5 Antibody in stock?

Recombinant LILRB5 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.