Recombinant CYTIP Antibody

Catalog number RN-10919-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-10919-01

Size / count 50 μL

Specifications

Catalog number: RN-10919-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cytohesin-interacting protein, Cytohesin binder and regulator, CYBR, Cytohesin-associated scaffolding protein, CASP, Cytohesin-binding protein HE, Cbp HE, Pleckstrin homology Sec7 and coiled-coil domains-binding protein
Gene Name: CYTIP
Gene ID: 9595
UniProt: O60759
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CYTIP
Target: PP-5700
Partner Proteins: Cytohesin-interacting protein; Cytohesin binder and regulator; CYBR; Cytohesin-associated scaffolding protein; CASP; Cytohesin-binding protein HE; Cbp HE; Pleckstrin homology Sec7 and coiled-coil domains-binding protein
Clone: K8U038_15B9
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 80%, Pig - 90%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDECFIPKEG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PSCDBP
Target Alternative Name: CYTIP
Host or Source: Mouse
Protein Name: Cytohesin 1 interacting protein
IHC description: Fail (Tonsil)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CYTIP Antibody?

The catalog number for Recombinant CYTIP Antibody is RN-10919.

What sizes are available for Recombinant CYTIP Antibody?

Recombinant CYTIP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CYTIP Antibody come in?

Recombinant CYTIP Antibody is available in 3 different pack sizes.

Is Recombinant CYTIP Antibody in stock?

Recombinant CYTIP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.