SIGLEC6 Antibody (Biotin)

Catalog number KB-7803-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7803-01

Size / count 50 μL

Specifications

Catalog number: KB-7803-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sialic acid-binding Ig-like lectin 6, Siglec-6, CD33 antigen-like 1, CDw327, Obesity-binding protein 1, OB-BP1, CD antigen CD327
Gene Name: SIGLEC6
Gene ID: 946
UniProt: O43699
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SIGLEC6
Target Antigen: CD327
Target: PP-695
Partner Proteins: Sialic acid-binding Ig-like lectin 6; Siglec-6; CD33 antigen-like 1; CDw327; Obesity-binding protein 1; OB-BP1; CD antigen CD327
Clone: K92048_9F8
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 37%, Pig - 51%, Cynomolgus monkey - 85%
Purity: ≥85%
Cores: KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 37%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CD33L; CD33L1; OBBP1
Target Alternative Name: SIGLEC6
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Sialic acid binding Ig like lectin 6
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for SIGLEC6 Antibody (Biotin)?

The catalog number for SIGLEC6 Antibody (Biotin) is KB-7803.

What sizes are available for SIGLEC6 Antibody (Biotin)?

SIGLEC6 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SIGLEC6 Antibody (Biotin) come in?

SIGLEC6 Antibody (Biotin) is available in 3 different pack sizes.

Is SIGLEC6 Antibody (Biotin) in stock?

SIGLEC6 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products