TNFSF14 Antibody (Biotin)

Catalog number KB-1325-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1325-01

Size / count 50 μL

Specifications

Catalog number: KB-1325-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor ligand superfamily member 14, Herpes virus entry mediator ligand, HVEM-L, Herpesvirus entry mediator ligand, CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form]
Gene Name: TNFSF14
Gene ID: 8740
UniProt: O43557
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFSF14
Target Antigen: CD258
Target: PQ-147
Partner Proteins: Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14; membrane form; Tumor necrosis factor ligand superfamily member 14; soluble form]
Clone: K70045_1E6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 31%, Pig - 80%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: EQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: HVEML; LIGHT
Target Alternative Name: TNFSF14
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: TNF superfamily member 14
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TNFSF14 Antibody (Biotin)?

The catalog number for TNFSF14 Antibody (Biotin) is KB-1325.

What sizes are available for TNFSF14 Antibody (Biotin)?

TNFSF14 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFSF14 Antibody (Biotin) come in?

TNFSF14 Antibody (Biotin) is available in 3 different pack sizes.

Is TNFSF14 Antibody (Biotin) in stock?

TNFSF14 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.