TNFSF14 Antibody (Biotin)

Catalog number KB-1326-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-1326-01

Size / count 50 μL

Specifications

Catalog number: KB-1326-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tumor necrosis factor ligand superfamily member 14, Herpes virus entry mediator ligand, HVEM-L, Herpesvirus entry mediator ligand, CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form, Tumor necrosis factor ligand superfamily member 14, soluble form]
Gene Name: TNFSF14
Gene ID: 8740
UniProt: O43557
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNFSF14
Target Antigen: CD258
Target: PQ-147
Partner Proteins: Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14; membrane form; Tumor necrosis factor ligand superfamily member 14; soluble form]
Clone: K70045_4A7
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 31%, Pig - 80%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: EQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: HVEML; LIGHT
Target Alternative Name: TNFSF14
Panel Description: Cytokines, CD Antigen
Host or Source: Mouse
Protein Name: TNF superfamily member 14
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TNFSF14 Antibody (Biotin)?

The catalog number for TNFSF14 Antibody (Biotin) is KB-1326.

What sizes are available for TNFSF14 Antibody (Biotin)?

TNFSF14 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNFSF14 Antibody (Biotin) come in?

TNFSF14 Antibody (Biotin) is available in 3 different pack sizes.

Is TNFSF14 Antibody (Biotin) in stock?

TNFSF14 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.