CCL25 Antibody (Biotin)

Catalog number KB-18470-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-18470-01

Size / count 50 μL

Specifications

Catalog number: KB-18470-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-C motif chemokine 25, Chemokine TECK, Small-inducible cytokine A25, Thymus-expressed chemokine
Gene Name: CCL25
Gene ID: 6370
UniProt: O15444
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CCL25
Target: PQ-074
Partner Proteins: C-C motif chemokine 25; Chemokine TECK; Small-inducible cytokine A25; Thymus-expressed chemokine
Clone: K52066_14D3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 45%, Pig - 55%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 45%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SCYA25; TECK
Target Alternative Name: CCL25
Host or Source: Mouse
Protein Name: C-C motif chemokine ligand 25
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for CCL25 Antibody (Biotin)?

The catalog number for CCL25 Antibody (Biotin) is KB-18470.

What sizes are available for CCL25 Antibody (Biotin)?

CCL25 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CCL25 Antibody (Biotin) come in?

CCL25 Antibody (Biotin) is available in 3 different pack sizes.

Is CCL25 Antibody (Biotin) in stock?

CCL25 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

All Products