TNRC18 Antibody (Biotin)

Catalog number KB-19705-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-19705-01

Size / count 50 μL

Specifications

Catalog number: KB-19705-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Trinucleotide repeat-containing gene 18 protein, Long CAG trinucleotide repeat-containing gene 79 protein
Gene Name: TNRC18
Gene ID: 84629
UniProt: O15417
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TNRC18
Target: PP-9393
Partner Proteins: Trinucleotide repeat-containing gene 18 protein; Long CAG trinucleotide repeat-containing gene 79 protein
Clone: K56033_19B3
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Pig - 92%
Purity: ≥85%
Cores: AKDRKDPRKKKKGKEAGPGAGLPPPRAPALPSEARAPHASSLTAAKRSKAKAKGKEVKKENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVERPLTPAPR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CAGL79; KIAA1856
Target Alternative Name: TNRC18
Host or Source: Mouse
Protein Name: Trinucleotide repeat containing 18
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TNRC18 Antibody (Biotin)?

The catalog number for TNRC18 Antibody (Biotin) is KB-19705.

What sizes are available for TNRC18 Antibody (Biotin)?

TNRC18 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TNRC18 Antibody (Biotin) come in?

TNRC18 Antibody (Biotin) is available in 3 different pack sizes.

Is TNRC18 Antibody (Biotin) in stock?

TNRC18 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

All Products