FYB Antibody (Biotin)

Catalog number KB-2071-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-2071-01

Size / count 50 μL

Specifications

Catalog number: KB-2071-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: FYN-binding protein 1, Adhesion and degranulation promoting adaptor protein, ADAP, FYB-120/130, p120/p130, FYN-T-binding protein, SLAP-130, SLP-76-associated phosphoprotein
Gene Name: FYB1
Gene ID: 2533
UniProt: O15117
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FYB1
Target: PP-687
Partner Proteins: FYN-binding protein 1; Adhesion and degranulation promoting adaptor protein; ADAP; FYB-120/130; p120/p130; FYN-T-binding protein; SLAP-130; SLP-76-associated phosphoprotein
Clone: K52054_5G1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 84%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEKKRLELEKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDSLGAPSRPIED
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 86%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: FYB; SLAP130
Target Alternative Name: FYB
Host or Source: Mouse
Protein Name: FYN binding protein 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for FYB Antibody (Biotin)?

The catalog number for FYB Antibody (Biotin) is KB-2071.

What sizes are available for FYB Antibody (Biotin)?

FYB Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does FYB Antibody (Biotin) come in?

FYB Antibody (Biotin) is available in 3 different pack sizes.

Is FYB Antibody (Biotin) in stock?

FYB Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products