CCL21 Antibody (Biotin)

Catalog number KB-7320-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-7320-01

Size / count 50 μL

Specifications

Catalog number: KB-7320-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: C-C motif chemokine 21, 6Ckine, Beta-chemokine exodus-2, Secondary lymphoid-tissue chemokine, SLC, Small-inducible cytokine A21
Gene Name: CCL21
Gene ID: 6366
UniProt: O00585
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CCL21
Target: PP-1384
Partner Proteins: C-C motif chemokine 21; 6Ckine; Beta-chemokine exodus-2; Secondary lymphoid-tissue chemokine; SLC; Small-inducible cytokine A21
Clone: K56023_9H10
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Rat - 46%, Pig - 74%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 69%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SCYA21
Target Alternative Name: CCL21
Host or Source: Mouse
Protein Name: C-C motif chemokine ligand 21
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CCL21 Antibody (Biotin)?

The catalog number for CCL21 Antibody (Biotin) is KB-7320.

What sizes are available for CCL21 Antibody (Biotin)?

CCL21 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CCL21 Antibody (Biotin) come in?

CCL21 Antibody (Biotin) is available in 3 different pack sizes.

Is CCL21 Antibody (Biotin) in stock?

CCL21 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

All Products