WASL Antibody (Biotin)

Catalog number KB-16592-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-16592-01

Size / count 50 μL

Specifications

Catalog number: KB-16592-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Actin nucleation-promoting factor WASL, Neural Wiskott-Aldrich syndrome protein, N-WASP
Gene Name: WASL
Gene ID: 8976
UniProt: O00401
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WASL
Target: PP-674
Partner Proteins: Actin nucleation-promoting factor WASL; Neural Wiskott-Aldrich syndrome protein; N-WASP
Clone: K94035_3A9
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: PPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: WASL
Host or Source: Mouse
Protein Name: WASP like actin nucleation promoting factor
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for WASL Antibody (Biotin)?

The catalog number for WASL Antibody (Biotin) is KB-16592.

What sizes are available for WASL Antibody (Biotin)?

WASL Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does WASL Antibody (Biotin) come in?

WASL Antibody (Biotin) is available in 3 different pack sizes.

Is WASL Antibody (Biotin) in stock?

WASL Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.