SULT1C2 Antibody (Biotin)

Catalog number KB-18582-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-18582-01

Size / count 50 μL

Specifications

Catalog number: KB-18582-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Sulfotransferase 1C2, ST1C2, Sulfotransferase 1C1, SULT1C#1, humSULTC2
Gene Name: SULT1C2
Gene ID: 6819
UniProt: O00338
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SULT1C2
Target: PP-10711
Partner Proteins: Sulfotransferase 1C2; ST1C2; Sulfotransferase 1C1; SULT1C#1; humSULTC2
Clone: K8U008_20F4
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 86%, Pig - 81%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: PKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: SULT1C1
Target Alternative Name: SULT1C2
Host or Source: Mouse
Protein Name: Sulfotransferase family 1C member 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for SULT1C2 Antibody (Biotin)?

The catalog number for SULT1C2 Antibody (Biotin) is KB-18582.

What sizes are available for SULT1C2 Antibody (Biotin)?

SULT1C2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does SULT1C2 Antibody (Biotin) come in?

SULT1C2 Antibody (Biotin) is available in 3 different pack sizes.

Is SULT1C2 Antibody (Biotin) in stock?

SULT1C2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.