BMPR1B Antibody (Biotin)

Catalog number KB-8128-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8128-01

Size / count 50 μL

Specifications

Catalog number: KB-8128-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Bone morphogenetic protein receptor type-1B, BMP type-1B receptor, BMPR-1B, CD antigen CDw293
Gene Name: BMPR1B
Gene ID: 658
UniProt: O00238
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BMPR1B
Target Antigen: CDw293
Target: PP-1511
Partner Proteins: Bone morphogenetic protein receptor type-1B; BMP type-1B receptor; BMPR-1B; CD antigen CDw293
Clone: K9N012_5F6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 52%, Pig - 98%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: TAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: BMPR1B
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Bone morphogenetic protein receptor type 1B
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for BMPR1B Antibody (Biotin)?

The catalog number for BMPR1B Antibody (Biotin) is KB-8128.

What sizes are available for BMPR1B Antibody (Biotin)?

BMPR1B Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does BMPR1B Antibody (Biotin) come in?

BMPR1B Antibody (Biotin) is available in 3 different pack sizes.

Is BMPR1B Antibody (Biotin) in stock?

BMPR1B Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.