Recombinant MROH2A Antibody

Catalog number RN-10644-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-10644-01

Size / count 50 μL

Specifications

Catalog number: RN-10644-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Maestro heat-like repeat-containing protein family member 2A, HEAT repeat-containing protein 7B1
Gene Name: MROH2A
Gene ID: 339766
UniProt: A6NES4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MROH2A
Target: PP-9792
Partner Proteins: Maestro heat-like repeat-containing protein family member 2A; HEAT repeat-containing protein 7B1
Clone: K16310_13H4
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 74%, Pig - 84%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: DDLGPLELHDSGTFQQVVNLLDIIDSESAKTDTTGAGLDMRKTLASVIIMEKATTEPSVVINTLIRCLQVPEISTQRKVNIYNILQDIIQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 74%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: HEATR7B1
Target Alternative Name: MROH2A
Host or Source: Mouse
Protein Name: Maestro heat like repeat family member 2A
WB Description: Succeed
IP description: Fail (Plasma (SH191-200P) )
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MROH2A Antibody?

The catalog number for Recombinant MROH2A Antibody is RN-10644.

What sizes are available for Recombinant MROH2A Antibody?

Recombinant MROH2A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MROH2A Antibody come in?

Recombinant MROH2A Antibody is available in 3 different pack sizes.

Is Recombinant MROH2A Antibody in stock?

Recombinant MROH2A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

All Products