MAP1LC3B/MAP1LC3B2 Antibody

Catalog number KC-33529-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-33529-01

Size / count 50 μL

Specifications

Catalog number: KC-33529-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Microtubule-associated proteins 1A/1B light chain 3 beta 2, Microtubule-associated proteins 1A/1B light chain 3B-like
Gene Name: MAP1LC3B2
Gene ID: 643246
UniProt: A6NCE7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MAP1LC3B2
Target: PP-4004
Partner Proteins: Microtubule-associated proteins 1A/1B light chain 3 beta 2; Microtubule-associated proteins 1A/1B light chain 3B-like
Clone: K29107_8F10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Recognizing both MAP1LC3B and MAP1LC3B2 with a shared epitope within the region between aa30 to the N-terminus of MAP1LC3B and MAP1LC3B2
Host or Source: Mouse
Protein Name: Microtubule associated protein 1 light chain 3 beta 2
WB Description: Fail (HEK-293 (50uM Chlorquine 8h), HEK-293)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for MAP1LC3B/MAP1LC3B2 Antibody?

The catalog number for MAP1LC3B/MAP1LC3B2 Antibody is KC-33529.

What sizes are available for MAP1LC3B/MAP1LC3B2 Antibody?

MAP1LC3B/MAP1LC3B2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MAP1LC3B/MAP1LC3B2 Antibody come in?

MAP1LC3B/MAP1LC3B2 Antibody is available in 3 different pack sizes.

Is MAP1LC3B/MAP1LC3B2 Antibody in stock?

MAP1LC3B/MAP1LC3B2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products