Product details

RuvB Like 1 Antibody

Catalog number KC-19852-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-19852-01

Size / count 50 μL

Specifications

Catalog number: KC-19852-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: RuvB-like 1, 49 kDa TATA box-binding protein-interacting protein, 49 kDa TBP-interacting protein, 54 kDa erythrocyte cytosolic protein, ECP-54, INO80 complex subunit H, Nuclear matrix protein 238, NMP 238, Pontin 52, TIP49a, TIP60-associated protein 54-alpha, TAP54-alpha
Gene Name: RUVBL1
Gene ID: 8607
UniProt: Q9Y265
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human RUVBL1
Target: PP-440
Partner Proteins: RuvB-like 1; 49 kDa TATA box-binding protein-interacting protein; 49 kDa TBP-interacting protein; 54 kDa erythrocyte cytosolic protein; ECP-54; INO80 complex subunit H; Nuclear matrix protein 238; NMP 238; Pontin 52; TIP49a; TIP60-associated protein 54-alpha; TAP54-alpha
Clone: K1E056_14A9
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: YEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: INO80H; NMP238; TIP49; TIP49A
Target Alternative Name: RuvB Like 1
Panel Description: DNA binding & Chromatin
Host or Source: Mouse
Protein Name: RuvB like AAA ATPase 1
WB Description: Succeed
IHC description: Succeed
IP description: Fail (Mouse Testis)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for RuvB Like 1 Antibody?

The catalog number for RuvB Like 1 Antibody is KC-19852.

What sizes are available for RuvB Like 1 Antibody?

RuvB Like 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does RuvB Like 1 Antibody come in?

RuvB Like 1 Antibody is available in 3 different pack sizes.

Is RuvB Like 1 Antibody in stock?

RuvB Like 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.