Recombinant FBXL5 Antibody

Catalog number RN-13216-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13216-01

Size / count 50 μL

Specifications

Catalog number: RN-13216-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: F-box/LRR-repeat protein 5, F-box and leucine-rich repeat protein 5, F-box protein FBL4/FBL5, p45SKP2-like protein
Gene Name: FBXL5
Gene ID: 26234
UniProt: Q9UKA1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FBXL5
Target: PP-8762
Partner Proteins: F-box/LRR-repeat protein 5; F-box and leucine-rich repeat protein 5; F-box protein FBL4/FBL5; p45SKP2-like protein
Clone: K92087_19G7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Pig - 98%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: GPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEESAEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQTDISD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: FBL4; FBL5; FLR1
Target Alternative Name: FBXL5
Panel Description: E3 Ligase, Ferroptosis, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: F-box and leucine rich repeat protein 5
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant FBXL5 Antibody?

The catalog number for Recombinant FBXL5 Antibody is RN-13216.

What sizes are available for Recombinant FBXL5 Antibody?

Recombinant FBXL5 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant FBXL5 Antibody come in?

Recombinant FBXL5 Antibody is available in 3 different pack sizes.

Is Recombinant FBXL5 Antibody in stock?

Recombinant FBXL5 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

All Products