Recombinant PSMC3IP Antibody — image 1 of 2

Product details

Recombinant PSMC3IP Antibody

Catalog number RN-13464-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13464-01

Size / count 50 μL

Specifications

Catalog number: RN-13464-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Homologous-pairing protein 2 homolog, Nuclear receptor coactivator GT198, PSMC3-interacting protein, Proteasome 26S ATPase subunit 3-interacting protein, Tat-binding protein 1-interacting protein, TBP-1-interacting protein
Gene Name: PSMC3IP
Gene ID: 29893
UniProt: Q9P2W1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PSMC3IP
Target: PP-10133
Partner Proteins: Homologous-pairing protein 2 homolog; Nuclear receptor coactivator GT198; PSMC3-interacting protein; Proteasome 26S ATPase subunit 3-interacting protein; Tat-binding protein 1-interacting protein; TBP-1-interacting protein
Clone: K1E058_13E10
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 89%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: VSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: HOP2; TBPIP
Target Alternative Name: PSMC3IP
Host or Source: Mouse
Protein Name: PSMC3 interacting protein
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PSMC3IP Antibody?

The catalog number for Recombinant PSMC3IP Antibody is RN-13464.

What sizes are available for Recombinant PSMC3IP Antibody?

Recombinant PSMC3IP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PSMC3IP Antibody come in?

Recombinant PSMC3IP Antibody is available in 3 different pack sizes.

Is Recombinant PSMC3IP Antibody in stock?

Recombinant PSMC3IP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products