Caspase-10 Antibody

Catalog number KC-7928-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7928-01

Size / count 50 μL

Specifications

Catalog number: KC-7928-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-10, CASP-10, Apoptotic protease Mch-4, FAS-associated death domain protein interleukin-1B-converting enzyme 2, FLICE2, ICE-like apoptotic protease 4) [Cleaved into: Caspase-10 subunit p23/17, Caspase-10 subunit p12]
Gene Name: CASP10
Gene ID: 843
UniProt: Q92851
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP10
Target: PP-1355
Partner Proteins: Caspase-10; CASP-10; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FLICE2; ICE-like apoptotic protease 4) [Cleaved into: Caspase-10 subunit p23/17; Caspase-10 subunit p12]
Clone: K56014_18D2
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 43%, Pig - 58%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: KTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEIL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 43%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MCH4
Target Alternative Name: Caspase-10
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Caspase 10
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Caspase-10 Antibody?

The catalog number for Caspase-10 Antibody is KC-7928.

What sizes are available for Caspase-10 Antibody?

Caspase-10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-10 Antibody come in?

Caspase-10 Antibody is available in 3 different pack sizes.

Is Caspase-10 Antibody in stock?

Caspase-10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.