Tryptase-I Antibody

Catalog number KC-3633-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3633-01

Size / count 50 μL

Specifications

Catalog number: KC-3633-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tryptase alpha/beta-1, Tryptase-1, Tryptase I, Tryptase alpha-1
Gene Name: TPSAB1
Gene ID: 7177
UniProt: Q15661
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TPSAB1
Target: P07353PAD
Partner Proteins: Tryptase alpha/beta-1; Tryptase-1; Tryptase I; Tryptase alpha-1
Clone: K29073_1F12
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 75%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TPS1; TPS2; TPSB1
Target Alternative Name: Tryptase-I
Host or Source: Mouse
Protein Name: Tryptase alpha/beta 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Tryptase-I Antibody?

The catalog number for Tryptase-I Antibody is KC-3633.

What sizes are available for Tryptase-I Antibody?

Tryptase-I Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tryptase-I Antibody come in?

Tryptase-I Antibody is available in 3 different pack sizes.

Is Tryptase-I Antibody in stock?

Tryptase-I Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.