Tryptase-I Antibody

Catalog number KC-3478-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3478-01

Size / count 50 μL

Specifications

Catalog number: KC-3478-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tryptase alpha/beta-1, Tryptase-1, Tryptase I, Tryptase alpha-1
Gene Name: TPSAB1
Gene ID: 7177
UniProt: Q15661
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TPSAB1
Target: P07353PAD
Partner Proteins: Tryptase alpha/beta-1; Tryptase-1; Tryptase I; Tryptase alpha-1
Clone: K29073_20C6
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 75%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TPS1; TPS2; TPSB1
Target Alternative Name: Tryptase-I
Host or Source: Mouse
Protein Name: Tryptase alpha/beta 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Tryptase-I Antibody?

The catalog number for Tryptase-I Antibody is KC-3478.

What sizes are available for Tryptase-I Antibody?

Tryptase-I Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Tryptase-I Antibody come in?

Tryptase-I Antibody is available in 3 different pack sizes.

Is Tryptase-I Antibody in stock?

Tryptase-I Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.