Caspase-8 Antibody

Catalog number KC-3673-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3673-01

Size / count 50 μL

Specifications

Catalog number: KC-3673-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-8, CASP-8, Apoptotic cysteine protease, Apoptotic protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like protease, FADD-like ICE, FLICE, ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog, MACH) [Cleaved into: Caspase-8 subunit p18, Caspase-8 subunit p10]
Gene Name: CASP8
Gene ID: 841
UniProt: Q14790
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP8
Target: P00536PAD
Partner Proteins: Caspase-8; CASP-8; Apoptotic cysteine protease; Apoptotic protease Mch-5; CAP4; FADD-homologous ICE/ced-3-like protease; FADD-like ICE; FLICE; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]
Clone: K29071_20A1
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 68%, Rat - 68%, Pig - 63%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: TTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 68%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MCH5
Target Alternative Name: Caspase-8
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Caspase 8
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-8 Antibody?

The catalog number for Caspase-8 Antibody is KC-3673.

What sizes are available for Caspase-8 Antibody?

Caspase-8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-8 Antibody come in?

Caspase-8 Antibody is available in 3 different pack sizes.

Is Caspase-8 Antibody in stock?

Caspase-8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products