Lysosome Membrane Protein 2 Antibody

Catalog number KC-7793-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7793-01

Size / count 50 μL

Specifications

Catalog number: KC-7793-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome membrane protein 2, 85 kDa lysosomal membrane sialoglycoprotein, LGP85, CD36 antigen-like 2, Lysosome membrane protein II, LIMP II, Scavenger receptor class B member 2, CD antigen CD36
Gene Name: SCARB2
Gene ID: 950
UniProt: Q14108
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SCARB2
Target Antigen: CD36
Target: PP-461
Partner Proteins: Lysosome membrane protein 2; 85 kDa lysosomal membrane sialoglycoprotein; LGP85; CD36 antigen-like 2; Lysosome membrane protein II; LIMP II; Scavenger receptor class B member 2; CD antigen CD36
Clone: K92051_6C9
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD36L2; LIMP2; LIMPII
Target Alternative Name: Lysosome Membrane Protein 2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Scavenger receptor class B member 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Lysosome Membrane Protein 2 Antibody?

The catalog number for Lysosome Membrane Protein 2 Antibody is KC-7793.

What sizes are available for Lysosome Membrane Protein 2 Antibody?

Lysosome Membrane Protein 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Lysosome Membrane Protein 2 Antibody come in?

Lysosome Membrane Protein 2 Antibody is available in 3 different pack sizes.

Is Lysosome Membrane Protein 2 Antibody in stock?

Lysosome Membrane Protein 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products