Lysosome Membrane Protein 2 Antibody

Catalog number KC-7791-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7791-01

Size / count 50 μL

Specifications

Catalog number: KC-7791-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome membrane protein 2, 85 kDa lysosomal membrane sialoglycoprotein, LGP85, CD36 antigen-like 2, Lysosome membrane protein II, LIMP II, Scavenger receptor class B member 2, CD antigen CD36
Gene Name: SCARB2
Gene ID: 950
UniProt: Q14108
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SCARB2
Target Antigen: CD36
Target: PP-461
Partner Proteins: Lysosome membrane protein 2; 85 kDa lysosomal membrane sialoglycoprotein; LGP85; CD36 antigen-like 2; Lysosome membrane protein II; LIMP II; Scavenger receptor class B member 2; CD antigen CD36
Clone: K92051_16B9
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD36L2; LIMP2; LIMPII
Target Alternative Name: Lysosome Membrane Protein 2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Scavenger receptor class B member 2
IHC description: Succeed
IP description: Fail (Rat Heart)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Lysosome Membrane Protein 2 Antibody?

The catalog number for Lysosome Membrane Protein 2 Antibody is KC-7791.

What sizes are available for Lysosome Membrane Protein 2 Antibody?

Lysosome Membrane Protein 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Lysosome Membrane Protein 2 Antibody come in?

Lysosome Membrane Protein 2 Antibody is available in 3 different pack sizes.

Is Lysosome Membrane Protein 2 Antibody in stock?

Lysosome Membrane Protein 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.