Liver Carboxylesterase 1 Antibody — image 1 of 2

Product details

Liver Carboxylesterase 1 Antibody

Catalog number KC-7960-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7960-01

Size / count 50 μL

Specifications

Catalog number: KC-7960-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Liver carboxylesterase 1, Acyl-coenzyme A:cholesterol acyltransferase, ACAT, Brain carboxylesterase hBr1, Carboxylesterase 1, CE-1, hCE-1, Cholesteryl ester hydrolase, CEH, Cocaine carboxylesterase, Egasyn, HMSE, Methylumbelliferyl-acetate deacetylase 1, Monocyte/macrophage serine esterase, Retinyl ester hydrolase, REH, Serine esterase 1, Triacylglycerol hydrolase, TGH
Gene Name: CES1
Gene ID: 1066
UniProt: P23141
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CES1
Target: PP-1675
Partner Proteins: Liver carboxylesterase 1; Acyl-coenzyme A:cholesterol acyltransferase; ACAT; Brain carboxylesterase hBr1; Carboxylesterase 1; CE-1; hCE-1; Cholesteryl ester hydrolase; CEH; Cocaine carboxylesterase; Egasyn; HMSE; Methylumbelliferyl-acetate deacetylase 1; Monocyte/macrophage serine esterase; Retinyl ester hydrolase; REH; Serine esterase 1; Triacylglycerol hydrolase; TGH
Clone: K1E067_13C2
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB&ELISA
Validation: Top_IHC&Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Rat - 80%, Pig - 77%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: GAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CES2; SES1
Target Alternative Name: Liver Carboxylesterase 1
Host or Source: Mouse
Protein Name: Carboxylesterase 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Liver Carboxylesterase 1 Antibody?

The catalog number for Liver Carboxylesterase 1 Antibody is KC-7960.

What sizes are available for Liver Carboxylesterase 1 Antibody?

Liver Carboxylesterase 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Liver Carboxylesterase 1 Antibody come in?

Liver Carboxylesterase 1 Antibody is available in 3 different pack sizes.

Is Liver Carboxylesterase 1 Antibody in stock?

Liver Carboxylesterase 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.