Liver Carboxylesterase 1 Antibody

Catalog number KC-8241-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-8241-01

Size / count 50 μL

Specifications

Catalog number: KC-8241-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Liver carboxylesterase 1, Acyl-coenzyme A:cholesterol acyltransferase, ACAT, Brain carboxylesterase hBr1, Carboxylesterase 1, CE-1, hCE-1, Cholesteryl ester hydrolase, CEH, Cocaine carboxylesterase, Egasyn, HMSE, Methylumbelliferyl-acetate deacetylase 1, Monocyte/macrophage serine esterase, Retinyl ester hydrolase, REH, Serine esterase 1, Triacylglycerol hydrolase, TGH
Gene Name: CES1
Gene ID: 1066
UniProt: P23141
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CES1
Target: PP-1675
Partner Proteins: Liver carboxylesterase 1; Acyl-coenzyme A:cholesterol acyltransferase; ACAT; Brain carboxylesterase hBr1; Carboxylesterase 1; CE-1; hCE-1; Cholesteryl ester hydrolase; CEH; Cocaine carboxylesterase; Egasyn; HMSE; Methylumbelliferyl-acetate deacetylase 1; Monocyte/macrophage serine esterase; Retinyl ester hydrolase; REH; Serine esterase 1; Triacylglycerol hydrolase; TGH
Clone: K1E067_13G12
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Rat - 80%, Pig - 77%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: GAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CES2; SES1
Target Alternative Name: Liver Carboxylesterase 1
Host or Source: Mouse
Protein Name: Carboxylesterase 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Liver Carboxylesterase 1 Antibody?

The catalog number for Liver Carboxylesterase 1 Antibody is KC-8241.

What sizes are available for Liver Carboxylesterase 1 Antibody?

Liver Carboxylesterase 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Liver Carboxylesterase 1 Antibody come in?

Liver Carboxylesterase 1 Antibody is available in 3 different pack sizes.

Is Liver Carboxylesterase 1 Antibody in stock?

Liver Carboxylesterase 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.