Clusterin Antibody

Catalog number KC-7933-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7933-01

Size / count 50 μL

Specifications

Catalog number: KC-7933-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Clusterin, Aging-associated gene 4 protein, Apolipoprotein J, Apo-J, Complement cytolysis inhibitor, CLI, Complement-associated protein SP-40, 40, Ku70-binding protein 1, NA1/NA2, Sulfated glycoprotein 2, SGP-2, Testosterone-repressed prostate message 2, TRPM-2) [Cleaved into: Clusterin beta chain, ApoJalpha, Complement cytolysis inhibitor a chain, SP-40, 40 beta-chain, Clusterin alpha chain, ApoJbeta, Complement cytolysis inhibitor b chain, SP-40, 40 alpha-chain]
Gene Name: CLU
Gene ID: 1191
UniProt: P10909
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CLU
Target: PP-740
Partner Proteins: Clusterin; Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40; 40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2) [Cleaved into: Clusterin beta chain; ApoJalpha; Complement cytolysis inhibitor a chain; SP-40; 40 beta-chain; Clusterin alpha chain; ApoJbeta; Complement cytolysis inhibitor b chain; SP-40; 40 alpha-chain]
Clone: K40049_15D9
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 81%, Pig - 81%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: LQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: APOJ; CLI; KUB1
Target Alternative Name: Clusterin
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Clusterin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Clusterin Antibody?

The catalog number for Clusterin Antibody is KC-7933.

What sizes are available for Clusterin Antibody?

Clusterin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Clusterin Antibody come in?

Clusterin Antibody is available in 3 different pack sizes.

Is Clusterin Antibody in stock?

Clusterin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.