Product details

Clusterin Antibody

Catalog number KC-7932-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7932-01

Size / count 50 μL

Specifications

Catalog number: KC-7932-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Clusterin, Aging-associated gene 4 protein, Apolipoprotein J, Apo-J, Complement cytolysis inhibitor, CLI, Complement-associated protein SP-40, 40, Ku70-binding protein 1, NA1/NA2, Sulfated glycoprotein 2, SGP-2, Testosterone-repressed prostate message 2, TRPM-2) [Cleaved into: Clusterin beta chain, ApoJalpha, Complement cytolysis inhibitor a chain, SP-40, 40 beta-chain, Clusterin alpha chain, ApoJbeta, Complement cytolysis inhibitor b chain, SP-40, 40 alpha-chain]
Gene Name: CLU
Gene ID: 1191
UniProt: P10909
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CLU
Target: PP-740
Partner Proteins: Clusterin; Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40; 40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2) [Cleaved into: Clusterin beta chain; ApoJalpha; Complement cytolysis inhibitor a chain; SP-40; 40 beta-chain; Clusterin alpha chain; ApoJbeta; Complement cytolysis inhibitor b chain; SP-40; 40 alpha-chain]
Clone: K40049_19B4
Conjugation: Unconjugated
Applications: Top_WB&ELISA
Validation: Top_WB&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 81%, Pig - 81%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: LQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: APOJ; CLI; KUB1
Target Alternative Name: Clusterin
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Clusterin
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Clusterin Antibody?

The catalog number for Clusterin Antibody is KC-7932.

What sizes are available for Clusterin Antibody?

Clusterin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Clusterin Antibody come in?

Clusterin Antibody is available in 3 different pack sizes.

Is Clusterin Antibody in stock?

Clusterin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.