Clusterin Antibody

Catalog number KC-7931-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7931-01

Size / count 50 μL

Specifications

Catalog number: KC-7931-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Clusterin, Aging-associated gene 4 protein, Apolipoprotein J, Apo-J, Complement cytolysis inhibitor, CLI, Complement-associated protein SP-40, 40, Ku70-binding protein 1, NA1/NA2, Sulfated glycoprotein 2, SGP-2, Testosterone-repressed prostate message 2, TRPM-2) [Cleaved into: Clusterin beta chain, ApoJalpha, Complement cytolysis inhibitor a chain, SP-40, 40 beta-chain, Clusterin alpha chain, ApoJbeta, Complement cytolysis inhibitor b chain, SP-40, 40 alpha-chain]
Gene Name: CLU
Gene ID: 1191
UniProt: P10909
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CLU
Target: PP-740
Partner Proteins: Clusterin; Aging-associated gene 4 protein; Apolipoprotein J; Apo-J; Complement cytolysis inhibitor; CLI; Complement-associated protein SP-40; 40; Ku70-binding protein 1; NA1/NA2; Sulfated glycoprotein 2; SGP-2; Testosterone-repressed prostate message 2; TRPM-2) [Cleaved into: Clusterin beta chain; ApoJalpha; Complement cytolysis inhibitor a chain; SP-40; 40 beta-chain; Clusterin alpha chain; ApoJbeta; Complement cytolysis inhibitor b chain; SP-40; 40 alpha-chain]
Clone: K40049_20H4
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 81%, Pig - 81%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: LQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: APOJ; CLI; KUB1
Target Alternative Name: Clusterin
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Clusterin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Clusterin Antibody?

The catalog number for Clusterin Antibody is KC-7931.

What sizes are available for Clusterin Antibody?

Clusterin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Clusterin Antibody come in?

Clusterin Antibody is available in 3 different pack sizes.

Is Clusterin Antibody in stock?

Clusterin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.