Anti-Human Lambda Antibody

Catalog number KC-7998-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7998-01

Size / count 50 μL

Specifications

Catalog number: KC-7998-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Immunoglobulin lambda constant 2, Ig lambda chain C region Kern, Ig lambda chain C region NIG-64, Ig lambda chain C region SH, Ig lambda chain C region X, Ig lambda-2 chain C region
Gene Name: IGLC2
Gene ID: 3538
UniProt: P0DOY2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IGLC2
Target: PP-3217
Partner Proteins: Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region
Clone: K40033_7G7
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 71%, Rat - 67%, Pig - 74%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 71%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Human Lambda
Panel Description: Immunoglobulin
Host or Source: Mouse
Protein Name: Immunoglobulin lambda constant 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Anti-Human Lambda Antibody?

The catalog number for Anti-Human Lambda Antibody is KC-7998.

What sizes are available for Anti-Human Lambda Antibody?

Anti-Human Lambda Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Anti-Human Lambda Antibody come in?

Anti-Human Lambda Antibody is available in 3 different pack sizes.

Is Anti-Human Lambda Antibody in stock?

Anti-Human Lambda Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

All Products