METTL15P1 Antibody

Catalog number KC-3614-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3614-01

Size / count 50 μL

Specifications

Catalog number: KC-3614-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative methyltransferase-like protein 15P1, Methyltransferase 5 domain-containing protein 2, Methyltransferase-like protein 15 pseudogene 1
Gene Name: METTL15P1
Gene ID: 100130758
UniProt: P0C7V9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human METTL15P1
Target: PP-9883
Partner Proteins: Putative methyltransferase-like protein 15P1; Methyltransferase 5 domain-containing protein 2; Methyltransferase-like protein 15 pseudogene 1
Clone: K1H006_6C5
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 87%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: QTQVQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: METT5D2
Target Alternative Name: METTL15P1
Host or Source: Mouse
Protein Name: Methyltransferase like 15 pseudogene 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for METTL15P1 Antibody?

The catalog number for METTL15P1 Antibody is KC-3614.

What sizes are available for METTL15P1 Antibody?

METTL15P1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does METTL15P1 Antibody come in?

METTL15P1 Antibody is available in 3 different pack sizes.

Is METTL15P1 Antibody in stock?

METTL15P1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

All Products