METTL15P1 Antibody

Catalog number KC-3729-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3729-01

Size / count 50 μL

Specifications

Catalog number: KC-3729-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative methyltransferase-like protein 15P1, Methyltransferase 5 domain-containing protein 2, Methyltransferase-like protein 15 pseudogene 1
Gene Name: METTL15P1
Gene ID: 100130758
UniProt: P0C7V9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human METTL15P1
Target: PP-9883
Partner Proteins: Putative methyltransferase-like protein 15P1; Methyltransferase 5 domain-containing protein 2; Methyltransferase-like protein 15 pseudogene 1
Clone: K1H006_15A7
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 87%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: QTQVQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: METT5D2
Target Alternative Name: METTL15P1
Host or Source: Mouse
Protein Name: Methyltransferase like 15 pseudogene 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for METTL15P1 Antibody?

The catalog number for METTL15P1 Antibody is KC-3729.

What sizes are available for METTL15P1 Antibody?

METTL15P1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does METTL15P1 Antibody come in?

METTL15P1 Antibody is available in 3 different pack sizes.

Is METTL15P1 Antibody in stock?

METTL15P1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

All Products