METTL15P1 Antibody

Catalog number KC-3585-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3585-01

Size / count 50 μL

Specifications

Catalog number: KC-3585-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative methyltransferase-like protein 15P1, Methyltransferase 5 domain-containing protein 2, Methyltransferase-like protein 15 pseudogene 1
Gene Name: METTL15P1
Gene ID: 100130758
UniProt: P0C7V9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human METTL15P1
Target: PP-9883
Partner Proteins: Putative methyltransferase-like protein 15P1; Methyltransferase 5 domain-containing protein 2; Methyltransferase-like protein 15 pseudogene 1
Clone: K1H006_17F11
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 87%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: QTQVQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: METT5D2
Target Alternative Name: METTL15P1
Host or Source: Mouse
Protein Name: Methyltransferase like 15 pseudogene 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for METTL15P1 Antibody?

The catalog number for METTL15P1 Antibody is KC-3585.

What sizes are available for METTL15P1 Antibody?

METTL15P1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does METTL15P1 Antibody come in?

METTL15P1 Antibody is available in 3 different pack sizes.

Is METTL15P1 Antibody in stock?

METTL15P1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

All Products