METTL15P1 Antibody

Catalog number KC-3704-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3704-01

Size / count 50 μL

Specifications

Catalog number: KC-3704-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative methyltransferase-like protein 15P1, Methyltransferase 5 domain-containing protein 2, Methyltransferase-like protein 15 pseudogene 1
Gene Name: METTL15P1
Gene ID: 100130758
UniProt: P0C7V9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human METTL15P1
Target: PP-9883
Partner Proteins: Putative methyltransferase-like protein 15P1; Methyltransferase 5 domain-containing protein 2; Methyltransferase-like protein 15 pseudogene 1
Clone: K1H006_17G5
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Pig - 87%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: QTQVQELHRSQDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGSSLRKDGPLDIRMDGGR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 79%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: METT5D2
Target Alternative Name: METTL15P1
Host or Source: Mouse
Protein Name: Methyltransferase like 15 pseudogene 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for METTL15P1 Antibody?

The catalog number for METTL15P1 Antibody is KC-3704.

What sizes are available for METTL15P1 Antibody?

METTL15P1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does METTL15P1 Antibody come in?

METTL15P1 Antibody is available in 3 different pack sizes.

Is METTL15P1 Antibody in stock?

METTL15P1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products