Recombinant AHI1-DT Antibody

Catalog number RN-14541-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14541-01

Size / count 50 μL

Specifications

Catalog number: RN-14541-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative uncharacterized protein encoded by LINC00271, AHI1 divergent transcript
Gene Name: AHI1-DT
Gene ID: 100131814
UniProt: P0C7V0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human AHI1-DT
Target: PP-9612
Partner Proteins: Putative uncharacterized protein encoded by LINC00271; AHI1 divergent transcript
Clone: K92101_8E8
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Purity: ≥85%
Cores: VKEAQKYGEDSQKSHSPGTPGPRSSVTTLSASALSDSSSPDTPPRRGPGRPSTPARAPATSAPMMYSRRGVRRTARPAGADTRSSANQLPQPSGACANADSAPPADVSACLRRRSHGDRCVPRSRRRPRP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C6orf217; LINC00271; NCRNA00271
Target Alternative Name: AHI1-DT
Host or Source: Mouse
Protein Name: AHI1 divergent transcript
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant AHI1-DT Antibody?

The catalog number for Recombinant AHI1-DT Antibody is RN-14541.

What sizes are available for Recombinant AHI1-DT Antibody?

Recombinant AHI1-DT Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant AHI1-DT Antibody come in?

Recombinant AHI1-DT Antibody is available in 3 different pack sizes.

Is Recombinant AHI1-DT Antibody in stock?

Recombinant AHI1-DT Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

All Products